PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0057s00490.1
Common NameLR48_Vigan03g315100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 250aa    MW: 26768.9 Da    PI: 7.8586
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0057s00490.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer993.6e-3150104358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       ++rY+eClkNhA+ +Ggha+DGCgEfm++ g+eg+++alkCaAC CHRnFHR+e++
  Vang0057s00490.1  50 RARYRECLKNHAVGIGGHALDGCGEFMAA-GTEGSIDALKCAACSCHRNFHRKESD 104
                       689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-2249102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-2851103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.3E-2952102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.06753102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.6E-32173248IPR009057Homeodomain-like
SuperFamilySSF466898.47E-19174247IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-25186242IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEFEDQEDQE EEQCMGAAAY DPARMKVPLG PEAVMAAQPV RSSTNGGAGR ARYRECLKNH  60
AVGIGGHALD GCGEFMAAGT EGSIDALKCA ACSCHRNFHR KESDGAGASV GGGDPYLVSH  120
HPLHHPPPPQ FAAYYRTPTG YLQVGGQARV AGTLALPSTS GGGGTQSTRE DQEDVSNPSA  180
GGTGSKKRFR TKFTQEQKDK MLELAEKLGW RIQKHDEGVV QAFCNETGVK RHVLKVWMHN  240
NKHTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-261852441675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520131.11e-162PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotA2Z2591e-76ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLA0A0S3T3360.0A0A0S3T336_PHAAN; Uncharacterized protein
TrEMBLA0A0L9UB560.0A0A0L9UB56_PHAAN; Uncharacterized protein
STRINGGLYMA02G04550.21e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]